Micron Document




German space programme
──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────
top
The German space programme is the set of projects funded by the government of Germany for the exploration and use of outer space. The space programme is run by the German Aerospace Center, who conduct research, plan, and implement the programme on behalf of the German federal government.

Contents

V-2
TEXUS
RETALT
Helios
STS-55
SAMPEX
ABRIXAS
LEO
Notes
Sources

──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────

History

While the idea of spaceflight had been explored by novels before, Hermann Oberth’s book Die Rakete zu den Planetenräumen was influential in propagating the idea of space flight. The book eventually inspired the establishment of the Verein für Raumschiffahrt (Society for Space Travel) in 1927, where amateur rocket scientists collaborated to advance the field of liquid-fueled rocketry.cite-ref-1[1] Between the 1930s and 1940s, Nazi Germany researched and built operational ballistic missiles capable of suborbital spaceflight.cite-ref-2[2]

Organisations

German Aerospace Center

The German Aerospace Center (German: Deutsches Zentrum für Luft- und Raumfahrt e.V., abbreviated DLR, literally German Center for Air- and Space-flight) is the national center for aerospace, energy and transportation research of Germany, founded in 1969. It is headquartered in Cologne with 35 locations throughout Germany. The DLR is engaged in a wide range of research and development projects in national and international partnerships.cite-ref-german-aerospace-center-dlrnumbers-3-0[3]

The DLR acts as the German

space agency

and is responsible for planning and implementing the German space programme on behalf of the

German federal government

. As a project management agency, DLR coordinates and answers the technical and organisational implementation of projects funded by a number of German federal ministries. As of 2020, the German Aerospace Center had a national budget of €1.348 billion.

Institute of Space Propulsion

The Institute of Space Propulsion in Lampoldshausen is one of the eight research centers of the German Aerospace Center (DLR).

Approximately 220 people work there in the fields of research and tests of

rocket engines

. The main purpose of the facility is the operation of test stands for space propulsion on behalf of the

European Space Agency (ESA)

and in cooperation with the European space industry.

Mission control centres

Columbus Control Centre

The Columbus Control Centre also known by its radio callsign, Mission Control Munich, is the mission control centre which is used to control the Columbus research laboratory, which is part of the International Space Station (ISS). The control centre is located at the German Aerospace Center (DLR) facility in Oberpfaffenhofen near Munich, Germany. The centre is operated by the DLR, under contract from the European Space Agency (ESA).

The Columbus Control Centre entered full-time operation during the

STS-122 Shuttle Mission

, which delivered the

Columbus

module to the ISS. The module was attached to the ISS on 11 February 2008.

European Space Operations Centre

The European Space Operations Centre (ESOC) serves as the main mission control centre for the European Space Agency (ESA) and is located in Darmstadt, Germany. ESOC's primary function is the operation of uncrewed spacecraft on behalf of ESA and the launch and early orbit phases (LEOP) of ESA and third-party missions.cite-ref-4[4] The Centre is also responsible for a range of operations-related activities within ESA and in cooperation with ESA's industry and international partners, including ground systems engineering, software development, flight dynamics and navigation, development of mission control tools and techniques and space debris studies.cite-ref-5[5]

ESOC's current major activities comprise operating planetary and solar missions, such as Mars Express and the Trace Gas Orbiter, astronomy & fundamental physics missions, such as Gaia and XMM Newton, and Earth observation missions such as CryoSat2 and Swarm.

ESOC is responsible for developing, operating and maintaining ESA's

ESTRACK network

of ground stations. Teams at the Centre are also involved in research and development related to advanced mission control concepts and Space Situational Awareness, and standardisation activities related to frequency management; mission operations; tracking,

telemetry

and telecommanding; and

space debris

.

German Space Operations Center

The

German Space Operations Center

(GSOC;

German

:

Deutsches Raumfahrt-Kontrollzentrum

) is the

mission control center

of

German Aerospace Center

(DLR) in

Oberpfaffenhofen

near

Munich

,

Germany

.

After the Federal Republic of Germany decided in the 1960s to launch a national space program and to participate in international space projects, the idea of having its own space control center became concrete. In 1967, then Federal Minister of Finance Franz Josef Strauss laid the foundation stone for the first building complex, which was opened a little later.

Until 1985, the Oberpfaffenhofen site of the then German Aerospace Research and Testing Institute (DFVLR) increasingly concentrated on spaceflight. The human spaceflight received special attention. The GSOC then accompanied two crewed missions: During STS-61-A in 1985, GSOC took over the control of the Spacelab, while flight control continued from NASA's Lyndon B. Johnson Space Center was acquired. For the first time, the Payload Operation Control Center (POCC) of a US space mission was directed outside of NASA. For the first time, a human spaceflight was partially monitored from outside the USA or the Soviet Union.cite-ref-7[7] During this mission, then Bavarian Prime Minister Franz Josef Strauss announced on 5 November 1985 an extensive investment program with which the role of Oberpfaffenhofen in European spaceflight should be increased.

The failure of Ariane 3 in 1985 and the Challenger disaster in 1986 slowed the development of the Oberpfaffenhofen and the GSOC. The investment program gave the GSOC a new building, Building 140. Construction began in April 1989.

In 1993, GSOC accompanied the entire operation with

STS-55

and had full payload control via the Spacelab. This was the first time that there was unfiltered access to all data.

Astronauts

As of 2024, twelve Germans have been in space. The first German, and only East German, in space was Sigmund Jähn in 1978. Three astronauts – Ulf Merbold, Reinhard Furrer and Ernst Messerschmid – represented West Germany during the time of divided Germany. Merbold made two other spaceflights after Germany was reunified in 1990. He is the only German to have been in space three times.

Thomas Reiter, Alexander Gerst, and Mathias Maurer have made long-term spaceflights. The other five astronauts are Klaus-Dietrich Flade, Hans Schlegel, Ulrich Walter, Reinhold Ewald, and Gerhard Thiele.

Rockets

V-2

The V2 (German: Vergeltungswaffe 2, lit. 'Vengeance Weapon 2'), with the technical name Aggregat-4 (A4), was the world's first long-rangecite-ref-8[8] guided ballistic missile. The missile, powered by a liquid-propellant rocket engine, was developed during the Second World War in Nazi Germany as a "vengeance weapon" and assigned to attack Allied cities as retaliation for the Allied bombings of German cities. The V2 rocket also became the first artificial object to travel into space by crossing the Kármán line (edge of space) with the vertical launch of MW 18014 on 20 June 1944.cite-ref-9[9]

Research of military use of long-range rockets began when the graduate studies of Wernher von Braun were noticed by the German Army. A series of prototypes culminated in the A4, which went to war as the V2. Beginning in September 1944, more than 3,000 V2s were launched by the Wehrmacht against Allied targets, first London and later Antwerp and Liège. According to a 2011 BBC documentary,cite-ref-footnoteramsey201689-10-0[10] the attacks from V-2s resulted in the deaths of an estimated 9,000 civilians and military personnel, while a further 12,000 labourers and concentration camp prisoners died as a result of their forced participation in the production of the weapons.cite-ref-v-2-rocket-thimm-11-0[11]

The rockets travelled at

supersonic speeds

, impacted without audible warning, and proved unstoppable. No

effective defense

existed. Teams from the

Allied forces

—the United States, the United Kingdom, France and the Soviet Union—raced to seize major German manufacturing facilities, procure the Germans'

missile technology

, and capture the V-2s' launching sites. Von Braun and more than 100 core

R&D

V-2

personnel surrendered to the Americans, and many of the original

V-2

team transferred their work to the

Redstone Arsenal

, where they were relocated as part of

Operation Paperclip

. The US also captured enough

V-2

hardware to build approximately 80 of the missiles. The Soviets gained possession of the

V-2

manufacturing facilities after the war, re-established

V-2

production, and moved it to the Soviet Union.

TEXUS

TEXUS is a European/German sounding rocket programme, serving the microgravity programmes of ESA and DLR. The launches are conducted from Esrange in Sweden.

The first mission was conducted on 13 December 1977, using a British

Skylark

rocket. All missions up to TEXUS-41 in 2004 were conducted using Skylark rockets. Following the Skylark's retirement in 2005, TEXUS launches switched to the Brazilian

VSB-30

rocket.

Liquid fly-back booster

Liquid Fly-back Booster (LFBB) was a German Aerospace Center's (DLR's) project concept to develop a liquid rocket booster capable of reuse for Ariane 5 in order to significantly reduce the high cost of space transportation and increase environmental friendliness.cite-ref-liquid-fly-back-booster-satellitenkatapult-12-0[12] LFBB would replace the existing solid rocket boosters, which provided the majority of thrust from liftoff to separation. Once separated, the two winged boosters would perform an atmospheric entry, go back autonomously to the French Guiana, and land horizontally on the airport like an aeroplane.

Additionally a family of derivative launch vehicles was proposed in order to take an advantage of economies of scale, further reducing launch costs. These derivatives include:

German Aerospace Center studied Liquid Fly-back Boosters as a part of future launcher research programme from 1999 to 2004.

After the cancellation of the project, publications at DLR continued until 2009.

SpaceLiner

SpaceLiner is a concept for a suborbital, hypersonic, winged passenger supersonic transport, conceived at the German Aerospace Center (Deutsches Zentrum für Luft- und Raumfahrt, or DLR) in 2005.cite-ref-spaceliner-klevanskij2005-14-0[14] In its second role the SpaceLiner is intended as a reusable launch vehicle (RLV) capable of delivering heavy payloads into orbit.cite-ref-spaceliner-iac2016-15-0[15]

The SpaceLiner is a very long-term project, and does not currently have funding lined up to initiate system

development

as of 2017. Projections in 2015 were that if adequate funding was eventually secured, the SpaceLiner concept might become an operational

spaceplane

in the 2040s.

RETALT

RETALT (RETro Propulsion Assisted Landing Technologies) is a project for aiming to investigate in key technologies for retropropulsion reusable launch systems established in March 2019 with funds from the European Union's Horizon 2020 program. It aims to "advance the research and development of key technologies for European vertical-landing launch vehicles."cite-ref-17[17]cite-ref-18[18]cite-ref-19[19]

The reference configurations for the development of the targeted technologies are two types of vertical launch and landing rockets a

two-stage-to-orbit

and a

single-stage to orbit

.

The partner organisations are

DLR

, CFS Engineering (Switzerland),

Elecnor Deimos

(Spain), MT Aerospace (Germany), Almatech (Switzerland) and Amorim Cork Composites (Portugal).

Missions operated by Germany

MW 18014

MW 18014

was a German

A-4 test rocket

launched on 20 June 1944,

at the

Peenemünde Army Research Center

in

Peenemünde

. It was the first man-made object to reach

outer space

, attaining an

apogee

of 176 kilometres (109 mi), well above the

Kármán line

that was established later as the lowest altitude of space.

It was a vertical test launch, and was not intended to reach

orbital velocity

, so it returned and impacted Earth, making it the first

sub-orbital spaceflight

.

Helios

Helios-A and Helios-B (after launch renamed Helios 1 and Helios 2) are a pair of probes that were launched into heliocentric orbit to study solar processes. As a joint venture between German Aerospace Center (DLR) and NASA, the probes were launched from Cape Canaveral Air Force Station, Florida, on December 10, 1974, and January 15, 1976, respectively.

The Helios project set a maximum speed record for spacecraft of 252,792 km/h (157,078 mph; 70,220 m/s).

Helios-B

performed the closest flyby of the

Sun

of any spacecraft until that time. The probes are no longer functional, but as of 2024 remain in

elliptical orbits

around the Sun.

STS-61-A

STS-61-A (also known as Spacelab D-1) was the 22nd mission of NASA's Space Shuttle program. It was a scientific Spacelab mission, funded and directed by West Germany – hence the non-NASA designation of D-1 (for Deutschland-1). STS-61-A was the ninth and last successful flight of Space Shuttle Challenger before the STS-51-L disaster. STS-61-A holds the current record for the largest crew—eight people—aboard any single spacecraft for the entire period from launch to landing.

The mission carried the NASA/

European Space Agency

(ESA) Spacelab module into orbit with 76 scientific experiments on board, and was declared a success.

Payload operations were controlled from the

German Space Operations Center

in

Oberpfaffenhofen

, West Germany, instead of from the regular NASA control center.

This was the first spaceflight to include multiple crewmembers from any single country other than the

United States

or

Soviet Union

. The crew also included the first Dutch citizen astronaut, payload specialist

Wubbo Ockels

.

STS-55

STS-55

, or Deutschland 2 (D-2), was the 55th overall flight of the

NASA

Space Shuttle

and the 14th flight of Shuttle

Columbia

. This flight was a multinational

Spacelab

flight involving 88 experiments from eleven different nations. The experiments ranged from

biology

sciences to simple

Earth observations

.

The D-2 mission, as it was commonly called, augmented the German

microgravity research

program started by the D-1 mission. The

German Aerospace Center

(DLR) had been tasked by the

German Space Agency

(DARA – Deutsche Agentur für Raumfahrtangelegenheiten) to conduct the second mission. DLR, NASA, the

European Space Agency

(ESA), and agencies in

France

and

Japan

contributed to D-2's scientific program. Eleven nations participated in the experiments. Of the 88 experiments conducted on the D-2 mission, four were sponsored by NASA.

SAMPEX

The

Solar Anomalous and Magnetospheric Particle Explorer

(SAMPEX or Explorer 68) was a

NASA

solar and magnetospheric observatory and was the first spacecraft in the

Small Explorer program

. It was launched into

low Earth orbit

on 3 July 1992, from

Vandenberg Air Force Base

(

Western Test Range

) aboard a

Scout G-1

launch vehicle

. SAMPEX was an international collaboration between NASA and the

Max Planck Institute for Extraterrestrial Physics

of

Germany

.

The Solar Anomalous and Magnetospheric Particle Explorer (SAMPEX) is the first of a series of spacecraft that was launched under the Small Explorer (SMEX) program for low-cost spacecraft.

ABRIXAS

A Broadband Imaging X-ray All-sky Survey, or ABRIXAS, was a space-based German X-ray telescope. It was launched on 28 April 1999 in a Kosmos-3M launch vehicle from Kapustin Yar, Russia, into Earth orbit. The orbit had a periapsis of 549.0 kilometres (341.1 mi), an apoapsis of 598.0 kilometres (371.6 mi), an inclination of 48.0° and an eccentricity of 0.00352, giving it a period of 96 minutes.cite-ref-abrixas-abrixas-trajectory-38-0[37]

The telescope's battery was accidentally overcharged and destroyed three days after the mission started. When attempts to communicate with the satellite – while its solar panels were illuminated by sunlight – failed, the $20 million project was abandoned.cite-ref-abrixas-abrixas-end-39-0[38] ABRIXAS decayed from orbit on 31 October 2017.

The

eROSITA

telescope was based on the design of the ABRIXAS observatory.

eROSITA was launched on board the

Spektr-RG

space observatory on 13 July 2019 from

Baikonur

to be deployed at the second

Lagrange point

(L2).

DLR-Tubsat

DLR-Tubsat

(

a.k.a.

TUBSAT

) was a German

remote sensing

microsatellite

, developed in a

joint venture

between

Technische Universität Berlin

(TUB) and

German Aerospace Center

(DLR). TU Berlin was responsible for the satellite bus and DLR was responsible for the payload.

The satellite was launched into

orbit

on 26 May 1999, on the fifth mission of the

PSLV

program

PSLV-C2

. The launch took place in the

Sriharikota Launching Range

.

The satellite had an expected life of one year.

TerraSAR-X

TerraSAR-X

is an

imaging radar

Earth observation satellite

, a joint venture being carried out under a public-private-partnership between the

German Aerospace Center

(DLR) and

EADS Astrium

. The exclusive commercial exploitation rights are held by the geo-information service provider

Astrium

. TerraSAR-X was launched on 15 June 2007 and has been in operational service since January 2008. With its twin satellite

TanDEM-X

, launched 21 June 2010, TerraSAR-X acquires the data basis for the

WorldDEM

, the worldwide and homogeneous

DEM

available from 2014.

Columbus

Columbus is a science laboratory that is part of the International Space Station (ISS) and is the largest single contribution to the ISS made by the European Space Agency (ESA).

Like the Harmony and Tranquility modules, the Columbus laboratory was constructed in Turin, Italy by Thales Alenia Space. The functional equipment and software of the lab was designed by EADS in Bremen, Germany. It was also integrated in Bremen before being flown to the Kennedy Space Center (KSC) in Florida in an Airbus Beluga. It was launched aboard Space Shuttle Atlantis on 7 February 2008, on flight STS-122. It is designed for ten years of operation. The module is controlled by the Columbus Control Centre, located at the German Space Operations Center, part of the German Aerospace Center in Oberpfaffenhofen near Munich, Germany.

The European Space Agency has spent


1.4 billion (about

US$

2 billion) on building

Columbus

, including the experiments it carries and the ground control infrastructure necessary to operate them.

Proposed missions

Baden-Württemberg 1

Baden-Württemberg 1 (BW1) was a proposed lunar mission spacecraft.cite-ref-baden-w-rttemberg-1-bd-49-0[48] The mission was led by the University of Stuttgart.cite-ref-50[49] The basic design was for a cubical spacecraft 1 meter on a side, with a mass of about 200 kg (441 lb).cite-ref-baden-w-rttemberg-1-stut-51-0[50] It may use an pulsed plasma thruster utilizing polytetrafluoroethylene (PTFE) as propellant.cite-ref-baden-w-rttemberg-1-bd-49-1[48] As of 2013 work on trajectories had been performed.cite-ref-52[51]

Baden-Württemberg 1 was part of the Stuttgart Small Satellite Program initiated in 2002 that included

FLYING LAPTOP

, PERSEUS, CERMIT, and the aforementioned BW-1.

LEO

LEO (Lunarer Erkundungsorbiter; English: Lunar Exploration Orbiter) was the name of a proposed German mission to the Moon, announced by the German Aerospace Center (DLR) Director Walter Doellinger on March 2, 2007. Because the necessary funding for 2009 was diverted elsewhere, the start of the project was delayed indefinitely.cite-ref-53[52]

Precise characteristics of the mission were announced in early 2008, and estimated costs were projected to be ca. €350 million (~$514 million) over five years. The mission would involve a lunar orbiter that DLR intended to build and launch in 2012 to map the lunar surface. It would be the first German mission to the Moon and the first European mission to the Moon since SMART-1.

Numerous leading German planetologists, among them

Gerhard Neukum

,

Ralf Jaumann

and Tilman Spohn, have condemned the indefinite postponement and argue for resuming the LEO-project.

See also

British space programme – Official efforts to develop space capabilities
Chinese space program – Space program of the People's Republic of China
Soviet space program – Space exploration program conducted by the Soviet Union from 1951 to 1991

Notes

cite-note-etymology-281. V-2 rockets were still known as A-4s until September 1944

References

cite-note-11. citerefhodapp2013Hodapp, Martin (2013). "Germany's Rocket Development in World War II". HOHONU. 11: 39.
cite-note-22. citerefneufeld1995Neufeld, Michael J (1995). The Rocket and the Reich: Peenemünde and the Coming of the Ballistic Missile Era. New York: The Free Press. pp. 158, 160–62, 190. ISBN 978-0-02-922895-1.
cite-note-german-aerospace-center-dlrnumbers-33. "DLR in Numbers". dlr.de. Archived from the original on 1 September 2023. Retrieved 1 September 2023.
cite-note-44. "ESA Spacecraft Operations – About us & frequently asked questions".
cite-note-55. "ESA's Ground Systems Engineering Team".
cite-note-62. "Where missions come alive".
cite-note-77. citerefandreas-sch-we1999Andreas Schöwe (1999). Mission Space Shuttle. Bechtermünz Verlag. p. 121. ISBN 3-8289-5357-3.
cite-note-88. "Long-range" in the context of the time. See NASA history article Archived 7 January 2009 at the Wayback Machine
cite-note-99. Neufeld, 1995 pp 158, 160–162, 190
cite-note-footnoteramsey201689-1010. Ramsey 2016, p. 89.
cite-note-v-2-rocket-thimm-1111. "Am Anfang war die V2. Vom Beginn der Weltraumschifffahrt in Deutschland". In: Utz Thimm (ed.): Warum ist es nachts dunkel? Was wir vom Weltall wirklich wissen. Kosmos, 2006, p. 158, ISBN 3-440-10719-1.
cite-note-liquid-fly-back-booster-satellitenkatapult-1212. "Sonnensegel und Satellitenkatapult" (in German). astronews.com. 4 April 2007. Retrieved 9 June 2015.
cite-note-liquid-fly-back-booster-longtermapplications-133. citerefsippelmanflettiburkhardt2005Sippel, Martin; Manfletti, Chiara; Burkhardt, Holger (28 September 2005). "Long-term/strategic scenario for reusable booster stages". Acta Astronautica. 58 (4). Elsevier (published 2006): 209–221. Bibcode:2006AcAau..58..209S. doi:10.1016/j.actaastro.2005.09.012. ISSN 0094-5765.
cite-note-spaceliner-klevanskij2005-1414. citerefsippelklevanskisteelant2005Sippel, M; Klevanski, J; Steelant, J (October 2005), "Comparative study on options for high-speed intercontinental passenger transports: air-breathing- vs. rocket-propelled" (PDF), Iac-05-D2.4.09
cite-note-spaceliner-iac2016-1515. citerefsippeltrivailobusslerlipp2016Sippel, M; Trivailo, O; Bussler, L; Lipp, S; Valluchi, C; Kaltenhäuser, S; Molina, R (September 2016), "Evolution of the SpaceLiner towards a Reusable TSTO-Launcher" (PDF), IAC-16-D2.4.03, 67th International Astronautical Congress, Guadalajara, Mexico
cite-note-spaceliner-2015aiaa-164. citerefsippelschwanekamptrivailokopp2015Sippel, M; Schwanekamp, T; Trivailo, O; Kopp, A; Bauer, C; Garbers, N (July 2015). SpaceLiner Technical Progress and Mission Definition (PDF). AIAA 2015-3582, 20th AIAA International Space Planes and Hypersonic Systems and Technologies Conference. Glasgow. doi:10.2514/6.2015-3582. ISBN 978-1-62410-320-9.
cite-note-1717. "RETALT". RETALT. 11 February 2018. Retrieved 26 June 2019.
cite-note-1818. citerefberger2019Berger, Eric (26 June 2019). "Europe says SpaceX "dominating" launch, vows to develop Falcon 9-like rocket". Ars Technica. Retrieved 26 June 2019.
cite-note-1919. "Le DLR veut des lanceurs réutilisables plus performants que le Falcon 9".
cite-note-205. "RETALT". RETALT. 11 February 2018. Retrieved 26 June 2019.
cite-note-216. citerefandrew-parsonson2019Andrew Parsonson (26 June 2019). "European Consortium Brazenly Announces Plans to Copy Falcon 9". rocketrundown.com. Retrieved 26 June 2019.
cite-note-227. "European reusable launch systems for more sustainability in spaceflight". Space Daily.
cite-note-238. citerefdlrDLR. "RETALT project European reusable launch systems for more sustainability in spaceflight". DLR Portal. Archived from the original on 26 June 2019. Retrieved 26 June 2019.
cite-note-249. "RETALT".
cite-note-2510. "European projects". CFS Engineering. 10 December 2018. Retrieved 13 February 2020.
cite-note-2611. "Almatech is part of the European project for the development of a Reusable Landing Rocket (RETALT)". Almatech. 24 June 2019. Retrieved 13 February 2020.
cite-note-2712. citerefportugalPortugal, Fullsix. "Cork integrated within programme for reusable space vehicles". Amorim Cork Composites. Retrieved 13 February 2020.
cite-note-mw-18014-psv-2913. citerefm-p-milazzol-kestayc-dundasu-s-geological-survey2017M.P. Milazzo; L. Kestay; C. Dundas; U.S. Geological Survey (2017). "The Challenge for 2050: Cohesive Analysis of More Than One Hundred Years of Planetary Data" (PDF). Planetary Science Vision 2050 Workshop. 1989. Planetary Science Division, NASA: 8070. Bibcode:2017LPICo1989.8070M. Retrieved 7 June 2019.
cite-note-mw-18014-earthfromspace-3014. citerefbrightsarosh2019Bright, Michael; Sarosh, Chloe (2019). Earth from Space. Introduction: Ebury Publishing. ISBN 9781473531604. Retrieved 7 June 2019.
cite-note-mw-18014-v-2-launches-at-peeuende-3115. citerefwadeWade, Mark. "Peenemuende". Astronautix.com. Archived from the original on 25 April 2005. Retrieved 7 June 2019.
cite-note-mw-18014-karman-line-3216. citerefwilliams2016Williams, Matt (16 September 2016). "How high is space?". Universe Today. Archived from the original on 2 June 2017. Retrieved 14 May 2017.
cite-note-helios-spacecraft-wilkinson2012-3317. citerefwilkinson2012Wilkinson, John (2012), New Eyes on the Sun: A Guide to Satellite Images and Amateur Observation, Astronomers' Universe Series, Springer, p. 37, Bibcode:2012nesg.book.....W, ISBN 978-3-642-22838-4
cite-note-sts-61-a-tfld1-3418. "German-run shuttle mission successful – Free Online Library". Thefreelibrary.com. 16 November 1985. Retrieved 18 May 2011.
cite-note-3519. "STS-61A Space Shuttle Challenger Mission". Space.about.com. Archived from the original on 7 July 2011. Retrieved 18 May 2011.
cite-note-solar-anomalous-and-magnetospheric-particle-explorer-mason1998-3620. citerefmason1998Mason, G. M.; et al. (1998). SAMPEX: NASA's first small explorer satellite. IEEE Aerospace Conference. March 21–28, 1998. Aspen, Colorado. Vol. 5. pp. 389–412. Bibcode:1998aero....5..389M. doi:10.1109/AERO.1998.685848.
cite-note-solar-anomalous-and-magnetospheric-particle-explorer-display-3721. "Display: SAMPEX (Explorer 68) 1992-038A". NASA. 28 October 2021. Retrieved 27 November 2021. This article incorporates text from this source, which is in the public domain.
cite-note-abrixas-abrixas-trajectory-3837. "NASA – NSSD – Spacecraft – Trajectory Details (ABRIXAS)". NASA. Retrieved 27 February 2008.
cite-note-abrixas-abrixas-end-3938. citerefwadeWade, Mark. "ABRIXAS". astronautix.com. Archived from the original on 28 December 2016. Retrieved 28 February 2008.
cite-note-abrixas-iki2005-4022. "Spectrum-RG/eRosita/Lobster mission definition document". Russian Space Research Institute. 30 October 2005. Archived from the original on 20 April 2024.
cite-note-abrixas-spektr-rg-4123. citerefzak2016Zak, Anatoly (16 April 2016). "Spektr-RG to expand horizons of X-ray astronomy". Russian Space Web. Retrieved 16 September 2016.
cite-note-dlr-tubsat-tubsat-4224. "TUBSAT". eoportal.org. Retrieved 9 July 2016.
cite-note-dlr-tubsat-dlr-tubsat-cospar-id-1999-029c-4325. "DLR-Tubsat (COSPAR ID: 1999-029C)". NASA. Retrieved 9 July 2016.
cite-note-dlr-tubsat-pslv-c2-4426. "PSLV-C2". Indian Space Research Organisation. Archived from the original on 2 April 2016. Retrieved 9 July 2016.
cite-note-dlr-tubsat-flight-experiences-with-dlr-tubsat-4527. "Flight Experiences With DLR-Tubsat". dlr.de. Retrieved 9 July 2016.
cite-note-dlr-tubsat-dlr-tubsat-qualification-of-high-precision-attitude-control-in-orbit-4628. citerefstecklingrennerr-ser1996Steckling, M.; Renner, U.; Röser, H.-P. (1996). "DLR-TUBSAT, qualification of high precision attitude control in orbit". Acta Astronautica. 39 (9–12): 951. Bibcode:1996AcAau..39..951S. doi:10.1016/S0094-5765(97)00081-7.
cite-note-dlr-tubsat-dlr-tubsat-a-microsatellite-for-interactive-earth-observation-4729. "DLR-TUBSAT: a microsatellite for interactive Earth observation". Retrieved 9 July 2016.
cite-note-4830. citerefharwood2008Harwood, William (11 February 2008). "Station arm pulls Columbus module from cargo bay". Spaceflightnow.com. Archived from the original on 7 May 2016. Retrieved 7 August 2009.
cite-note-baden-w-rttemberg-1-bd-4948. "Germany - Land of Ideas: Elring-Klinger drives satellite". Elring-Klinger. 20 November 2008. Archived from the original on 18 March 2014.
cite-note-5049. citerefbenaroya2010Benaroya, Haym, ed. (2010). Lunar Settlements. CRC Press. p. 476. ISBN 9781420083330.
cite-note-baden-w-rttemberg-1-stut-5150. citereflauferroeser2006Laufer, R.; Roeser, H.-P. (2006). LUNAR MISSION BW1 - A Small Lunar Exploration and Technology Demonstration Satellite. European Planetary Science Congress 2006. Berlin. p. 488. Bibcode:2006epsc.conf..488L.
cite-note-5251. citerefshimmin2013Shimmin, Rogan (2013). Trajectory design for a very-low-thrust lunar mission (PhD thesis). University of Adelaide, School of Mechanical Engineering. hdl:2440/80842.
cite-note-5352. ""Leo" fliegt nicht zum Mond (Leo does not fly to the moon)". tagesschau.
cite-note-5431. Europlanet: Erklärung zur Äußerung des Bundesministers für Wirtschaft und Technologie, die vom Deutschen Zentrum für Luft- und Raumfahrt (DLR) vorgeschlagene Mondmission Lunarer Explorations-Orbiter (LEO) zurückzustellen Archived 2011-09-29 at the Wayback Machine

Sources

• citereframsey2016Ramsey, Syed (2016). Tools of War: History of Weapons in Modern Times. Vij Books India Pvt Ltd. ISBN 978-93-86019-83-7.

External links

• German technology in 1969
• German technology and the Moon October 2019